Lineage for d1sra__ (1sra -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.3: Osteonectin [47489] (1 protein) Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries) 
Domain d1sra__: 1sra - [17190]
Details for d1sra__
PDB Entry: 1sra (more details), 2 Å
PDB Description: structure of a novel extracellular ca2+-binding module in bm-40(slash)sparc(slash)osteonectin
SCOP Domain Sequences for d1sra__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sra__ a.39.1.3 (-) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
cdldndkyialdewagcfgikqkdidkdlvi
SCOP Domain Coordinates for d1sra__:
Click to download the PDB-style file with coordinates for d1sra__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sra__:
- d1sra__ first appeared (with stable ids) in SCOP 1.55
- d1sra__ appears in SCOP 1.59
- d1sra__ appears in SCOP 1.63
- d1sra__ appears in the current release, SCOPe 2.08, called d1sraa_
View in 3D