Lineage for d1sraa_ (1sra A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710468Family a.39.1.3: Osteonectin [47489] (1 protein)
    5 helices; two EF-hands plus one of additional helices in the N-terminal part
  6. 2710469Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 2710470Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 2710471Domain d1sraa_: 1sra A: [17190]
    this domain only
    complexed with ca

Details for d1sraa_

PDB Entry: 1sra (more details), 2 Å

PDB Description: structure of a novel extracellular ca2+-binding module in bm-40(slash)sparc(slash)osteonectin
PDB Compounds: (A:) sparc

SCOPe Domain Sequences for d1sraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
cdldndkyialdewagcfgikqkdidkdlvi

SCOPe Domain Coordinates for d1sraa_:

Click to download the PDB-style file with coordinates for d1sraa_.
(The format of our PDB-style files is described here.)

Timeline for d1sraa_: