SCOPe 2.05: Domain d3aa8a_: 3aa8 A:

Lineage for d3aa8a_ (3aa8 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Escherichia coli [TaxId:562] [102973] (5 PDB entries)

8. Domain d3aa8a_: 3aa8 A: [171898]
   automated match to d1naqa_
   mutant

Details for d3aa8a_

PDB Entry: 3aa8, 2.3 Å

PDB Description: Crystal Structure Analysis of the Mutant CutA1 (S11V/E61V) from E. coli

PDB Compounds: (A:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3aa8a_:

Sequence; same for both SEQRES and ATOM records:

>d3aa8a_ d.58.5.2 (A:) Cut A1 {Escherichia coli [TaxId: 562]}
tavvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyvvqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl

Timeline for d3aa8a_:

• d3aa8a_ first appeared in SCOPe 2.01
  
• d3aa8a_ appears in SCOPe 2.04
  
• d3aa8a_ appears in SCOPe 2.06
  
• d3aa8a_ appears in the current release, SCOPe 2.08