![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
![]() | Protein Cut A1 [89931] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [102973] (5 PDB entries) |
![]() | Domain d3aa8a_: 3aa8 A: [171898] automated match to d1naqa_ mutant |
PDB Entry: 3aa8 (more details), 2.3 Å
SCOPe Domain Sequences for d3aa8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aa8a_ d.58.5.2 (A:) Cut A1 {Escherichia coli [TaxId: 562]} tavvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyvvqmilkt tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl
Timeline for d3aa8a_: