Lineage for d3aa3a_ (3aa3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859087Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1859265Protein RNase H (RNase HI) [53100] (4 species)
  7. 1859266Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
    Uniprot P0A7Y4
  8. 1859305Domain d3aa3a_: 3aa3 A: [171893]
    automated match to d1rcha_

Details for d3aa3a_

PDB Entry: 3aa3 (more details), 2.2 Å

PDB Description: A52L E. coli RNase HI
PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d3aa3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aa3a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmalivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

SCOPe Domain Coordinates for d3aa3a_:

Click to download the PDB-style file with coordinates for d3aa3a_.
(The format of our PDB-style files is described here.)

Timeline for d3aa3a_: