Lineage for d3a8xa1 (3a8x A:240-579)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1145 PDB entries)
  8. 2546976Domain d3a8xa1: 3a8x A:240-579 [171884]
    Other proteins in same PDB: d3a8xa2, d3a8xb2
    automated match to d1o6la_
    complexed with so4

Details for d3a8xa1

PDB Entry: 3a8x (more details), 2 Å

PDB Description: crystal structure of pkciota kinase domain
PDB Compounds: (A:) Protein kinase C iota type

SCOPe Domain Sequences for d3a8xa1:

Sequence, based on SEQRES records: (download)

>d3a8xa1 d.144.1.0 (A:240-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lglqdfdllrvigrgsyakvllvrlkktdriyamkvvkkelvnddedidwvqtekhvfeq
asnhpflvglhscfqtesrlffvieyvnggdlmfhmqrqrklpeeharfysaeislalny
lhergiiyrdlkldnvlldseghikltdygmckeglrpgdttstfcgtpnyiapeilrge
dygfsvdwwalgvlmfemmagrspfdivgssdnpdqntedylfqvilekqiriprslsvk
aasvlksflnkdpkerlgchpqtgfadiqghpffrnvdwdmmeqkqvvppfkpnisgefg
ldnfdsqftnepvqltpddddivrkidqsefegfeyinpl

Sequence, based on observed residues (ATOM records): (download)

>d3a8xa1 d.144.1.0 (A:240-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lglqdfdllrvigrgsyakvllvrlkktdriyamkvvkkelvnddedidwvqtekhvfeq
asnhpflvglhscfqtesrlffvieyvnggdlmfhmqrqrklpeeharfysaeislalny
lhergiiyrdlkldnvlldseghikltdygmckeglrpgdttstfcgtpnyiapeilrge
dygfsvdwwalgvlmfemmagrspfdivgstedylfqvilekqiriprslsvkaasvlks
flnkdpkerlgchpqtgfadiqghpffrnvdwdmmeqkqvvppfkpnisgefgldnfdsq
ftnepvqltpddddivrkidqsefegfeyinpl

SCOPe Domain Coordinates for d3a8xa1:

Click to download the PDB-style file with coordinates for d3a8xa1.
(The format of our PDB-style files is described here.)

Timeline for d3a8xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a8xa2