Lineage for d1e8aa_ (1e8a A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3199Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 3200Protein Calcyclin (S100) [47479] (9 species)
  7. 3205Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (1 PDB entry)
  8. 3206Domain d1e8aa_: 1e8a A: [17188]

Details for d1e8aa_

PDB Entry: 1e8a (more details), 1.95 Å

PDB Description: the three-dimensional structure of human s100a12
PDB Compounds: (A:)

SCOP Domain Sequences for d1e8aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyh

SCOP Domain Coordinates for d1e8aa_:

Click to download the PDB-style file with coordinates for d1e8aa_.
(The format of our PDB-style files is described here.)

Timeline for d1e8aa_: