SCOPe 2.08: Domain d3a8lb_: 3a8l B:

Lineage for d3a8lb_ (3a8l B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension
   automatically mapped to Pfam PF02211

6. Protein Iron-containing nitrile hydratase [50102] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
   also Rhodococcus sp. R312

8. Domain d3a8lb_: 3a8l B: [171878]
   Other proteins in same PDB: d3a8la_
   automated match to d1ahjb_
   complexed with fe; mutant

Details for d3a8lb_

PDB Entry: 3a8l, 1.63 Å

PDB Description: crystal structure of photo-activation state of nitrile hydratase mutant s113a

PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d3a8lb_:

Sequence; same for both SEQRES and ATOM records:

>d3a8lb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

Timeline for d3a8lb_:

• d3a8lb_ first appeared in SCOPe 2.01
  
• d3a8lb_ appears in SCOPe 2.07