Lineage for d3a8ke_ (3a8k E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082732Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2082733Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2082778Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 2082779Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)
  8. 2082782Domain d3a8ke_: 3a8k E: [171875]
    Other proteins in same PDB: d3a8ka1, d3a8ka2, d3a8kb1, d3a8kb2, d3a8kc1, d3a8kc2, d3a8kd1, d3a8kd2
    automated match to d1onla_

Details for d3a8ke_

PDB Entry: 3a8k (more details), 1.95 Å

PDB Description: crystal structure of etd97n-ehred complex
PDB Compounds: (E:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a8ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8ke_ b.84.1.1 (E:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
ealled

SCOPe Domain Coordinates for d3a8ke_:

Click to download the PDB-style file with coordinates for d3a8ke_.
(The format of our PDB-style files is described here.)

Timeline for d3a8ke_: