Lineage for d3a8je_ (3a8j E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817438Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2817439Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2817484Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 2817485Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)
  8. 2817490Domain d3a8je_: 3a8j E: [171873]
    Other proteins in same PDB: d3a8ja1, d3a8ja2, d3a8jb1, d3a8jb2, d3a8jc1, d3a8jc2, d3a8jd1, d3a8jd2
    automated match to d1onla_

Details for d3a8je_

PDB Entry: 3a8j (more details), 1.98 Å

PDB Description: Crystal Structure of ET-EHred complex
PDB Compounds: (E:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a8je_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8je_ b.84.1.1 (E:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
yealled

SCOPe Domain Coordinates for d3a8je_:

Click to download the PDB-style file with coordinates for d3a8je_.
(The format of our PDB-style files is described here.)

Timeline for d3a8je_: