Lineage for d1mr8b_ (1mr8 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640684Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 640685Protein Calcyclin (S100) [47479] (17 species)
  7. 640713Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (2 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 640721Domain d1mr8b_: 1mr8 B: [17187]
    complexed with oc1

Details for d1mr8b_

PDB Entry: 1mr8 (more details), 1.9 Å

PDB Description: migration inhibitory factor-related protein 8 from human
PDB Compounds: (B:) migration inhibitory factor-related protein 8

SCOP Domain Sequences for d1mr8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mr8b_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshees

SCOP Domain Coordinates for d1mr8b_:

Click to download the PDB-style file with coordinates for d1mr8b_.
(The format of our PDB-style files is described here.)

Timeline for d1mr8b_: