Lineage for d1mr8b_ (1mr8 B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47532Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 47533Protein Calcyclin (S100) [47479] (9 species)
  7. 47541Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (1 PDB entry)
  8. 47543Domain d1mr8b_: 1mr8 B: [17187]

Details for d1mr8b_

PDB Entry: 1mr8 (more details), 1.9 Å

PDB Description: migration inhibitory factor-related protein 8 from human

SCOP Domain Sequences for d1mr8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mr8b_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshees

SCOP Domain Coordinates for d1mr8b_:

Click to download the PDB-style file with coordinates for d1mr8b_.
(The format of our PDB-style files is described here.)

Timeline for d1mr8b_: