Lineage for d3a8ga_ (3a8g A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044346Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1044347Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 1044348Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
  6. 1044367Protein automated matches [190256] (4 species)
    not a true protein
  7. 1044374Species Rhodococcus erythropolis [TaxId:1833] [187042] (17 PDB entries)
  8. 1044375Domain d3a8ga_: 3a8g A: [171867]
    Other proteins in same PDB: d3a8gb_
    automated match to d2ahja_
    complexed with fe, mg, no, tan; mutant

Details for d3a8ga_

PDB Entry: 3a8g (more details), 1.11 Å

PDB Description: crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d3a8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8ga_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcactawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt

SCOPe Domain Coordinates for d3a8ga_:

Click to download the PDB-style file with coordinates for d3a8ga_.
(The format of our PDB-style files is described here.)

Timeline for d3a8ga_: