| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) ![]() duplication: contains two structural repeats |
| Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) |
| Protein automated matches [190256] (4 species) not a true protein |
| Species Rhodococcus erythropolis [TaxId:1833] [187042] (17 PDB entries) |
| Domain d3a8ga_: 3a8g A: [171867] Other proteins in same PDB: d3a8gb_ automated match to d2ahja_ complexed with fe, mg, no, tan; mutant |
PDB Entry: 3a8g (more details), 1.11 Å
SCOPe Domain Sequences for d3a8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a8ga_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcactawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt
Timeline for d3a8ga_: