SCOPe 2.08: Domain d1mr8a_: 1mr8 A:

Lineage for d1mr8a_ (1mr8 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries)
   Migration inhibitory factor-related protein 8

8. Domain d1mr8a_: 1mr8 A: [17186]
   complexed with ca

Details for d1mr8a_

PDB Entry: 1mr8, 1.9 Å

PDB Description: migration inhibitory factor-related protein 8 from human

PDB Compounds: (A:) migration inhibitory factor-related protein 8

SCOPe Domain Sequences for d1mr8a_:

Sequence; same for both SEQRES and ATOM records:

>d1mr8a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshees

Timeline for d1mr8a_:

• d1mr8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1mr8a_ appears in SCOPe 2.07