SCOPe 2.04: Domain d3a80a_: 3a80 A:

Lineage for d3a80a_ (3a80 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (393 PDB entries)
   Uniprot P00760

8. Domain d3a80a_: 3a80 A: [171855]
   automated match to d1aq7a_
   complexed with ca, o15

Details for d3a80a_

PDB Entry: 3a80, 1.75 Å

PDB Description: Crystal Structure of Trypsin complexed with (E)-2-(4-carbamimidoylbenzylideneaminooxy)-2-methylpropanoic acid (soaking 40seconds)

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3a80a_:

Sequence; same for both SEQRES and ATOM records:

>d3a80a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3a80a_:

• d3a80a_ first appeared in SCOPe 2.01
  
• d3a80a_ appears in SCOPe 2.03
  
• d3a80a_ appears in SCOPe 2.05
  
• d3a80a_ appears in the current release, SCOPe 2.08