Lineage for d3a7xa_ (3a7x A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388843Protein Trypsin(ogen) [50515] (9 species)
  7. 2388861Species Cow (Bos taurus) [TaxId:9913] [50516] (442 PDB entries)
    Uniprot P00760
  8. 2388987Domain d3a7xa_: 3a7x A: [171852]
    automated match to d1aq7a_
    complexed with ca, gol, o09

Details for d3a7xa_

PDB Entry: 3a7x (more details), 1.75 Å

PDB Description: Crystal Structure of Trypsin complexed with (E)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking 45seconds)
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3a7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7xa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3a7xa_:

Click to download the PDB-style file with coordinates for d3a7xa_.
(The format of our PDB-style files is described here.)

Timeline for d3a7xa_: