SCOPe 2.07: Domain d3a7sa_: 3a7s A:

Lineage for d3a7sa_ (3a7s A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (51 PDB entries)

8. Domain d3a7sa_: 3a7s A: [171848]
   automated match to d1ucha_
   complexed with cl

Details for d3a7sa_

PDB Entry: 3a7s, 2.2 Å

PDB Description: catalytic domain of uch37

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase isozyme L5

SCOPe Domain Sequences for d3a7sa_:

Sequence, based on SEQRES records:

>d3a7sa_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpi
dlgacnqddwisavrpviekriqkysegeirfnlmaivsd

Sequence, based on observed residues (ATOM records):

>d3a7sa_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp
viekriqkysegeirfnlmaivsd

Timeline for d3a7sa_:

• d3a7sa_ first appeared in SCOPe 2.01
  
• d3a7sa_ appears in SCOPe 2.06
  
• d3a7sa_ appears in the current release, SCOPe 2.08