Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.1: COMT-like [53336] (4 proteins) |
Protein Catechol O-methyltransferase, COMT [53337] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [267759] (9 PDB entries) |
Domain d3a7ea_: 3a7e A: [171846] automated match to d1h1da_ protein/RNA complex; complexed with dnc, mg, sam |
PDB Entry: 3a7e (more details), 2.8 Å
SCOPe Domain Sequences for d3a7ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7ea_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Human (Homo sapiens) [TaxId: 9606]} dtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsvl lelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqdi ipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdflah vrgsscfecthyqsfleyrevvdglekaiykg
Timeline for d3a7ea_: