Lineage for d3a7ea_ (3a7e A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1378490Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 1378509Protein automated matches [190251] (3 species)
    not a true protein
  7. 1378510Species Human (Homo sapiens) [TaxId:9606] [188458] (4 PDB entries)
  8. 1378514Domain d3a7ea_: 3a7e A: [171846]
    automated match to d1h1da_
    protein/RNA complex; complexed with dnc, mg, sam

Details for d3a7ea_

PDB Entry: 3a7e (more details), 2.8 Å

PDB Description: Crystal structure of human COMT complexed with SAM and 3,5-dinitrocatechol
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d3a7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7ea_ c.66.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsvl
lelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqdi
ipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdflah
vrgsscfecthyqsfleyrevvdglekaiykg

SCOPe Domain Coordinates for d3a7ea_:

Click to download the PDB-style file with coordinates for d3a7ea_.
(The format of our PDB-style files is described here.)

Timeline for d3a7ea_: