Lineage for d3a78a_ (3a78 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729757Domain d3a78a_: 3a78 A: [171844]
    automated match to d1ie9a_
    complexed with 3ev, so4

Details for d3a78a_

PDB Entry: 3a78 (more details), 1.9 Å

PDB Description: crystal structure of the human vdr ligand binding domain bound to the natural metabolite 1alpha,25-dihydroxy-3-epi-vitamin d3
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3a78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a78a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

SCOPe Domain Coordinates for d3a78a_:

Click to download the PDB-style file with coordinates for d3a78a_.
(The format of our PDB-style files is described here.)

Timeline for d3a78a_: