SCOPe 2.06: Domain d3a77d_: 3a77 D:

Lineage for d3a77d_ (3a77 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
   weak sequence similarity to SMAD domain

6. Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)

8. Domain d3a77d_: 3a77 D: [171843]
   automated match to d1qwta_
   complexed with acy, mpd

Details for d3a77d_

PDB Entry: 3a77, 1.8 Å

PDB Description: The crystal structure of phosphorylated IRF-3

PDB Compounds: (D:) Interferon regulatory factor 3

SCOPe Domain Sequences for d3a77d_:

Sequence, based on SEQRES records:

>d3a77d_ b.26.1.3 (D:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdpg
msltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdg
evpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvp
tclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpge

Sequence, based on observed residues (ATOM records):

>d3a77d_ b.26.1.3 (D:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvglpgwpvtlpdpgmsltdrg
vmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpkdke
ggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclralv
emarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpge

Timeline for d3a77d_:

• d3a77d_ first appeared in SCOPe 2.01
  
• d3a77d_ appears in SCOPe 2.05
  
• d3a77d_ appears in SCOPe 2.07
  
• d3a77d_ appears in the current release, SCOPe 2.08