Class b: All beta proteins [48724] (180 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein) weak sequence similarity to SMAD domain |
Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries) |
Domain d3a77b_: 3a77 B: [171841] automated match to d1qwta_ complexed with acy, mpd |
PDB Entry: 3a77 (more details), 1.8 Å
SCOPe Domain Sequences for d3a77b_:
Sequence, based on SEQRES records: (download)
>d3a77b_ b.26.1.3 (B:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]} enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpge
>d3a77b_ b.26.1.3 (B:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]} enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsetlpgwpvtlpdpgmsl tdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevp kdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptcl ralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpge
Timeline for d3a77b_: