Lineage for d3a77a_ (3a77 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049541Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2049542Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2049651Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
    weak sequence similarity to SMAD domain
  6. 2049652Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)
  7. 2049653Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)
  8. 2049654Domain d3a77a_: 3a77 A: [171840]
    automated match to d1qwta_
    complexed with acy, mpd

Details for d3a77a_

PDB Entry: 3a77 (more details), 1.8 Å

PDB Description: The crystal structure of phosphorylated IRF-3
PDB Compounds: (A:) Interferon regulatory factor 3

SCOPe Domain Sequences for d3a77a_:

Sequence, based on SEQRES records: (download)

>d3a77a_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges

Sequence, based on observed residues (ATOM records): (download)

>d3a77a_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvtlpgwpvtlpdpgmsltdr
gvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpkdk
eggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclral
vemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges

SCOPe Domain Coordinates for d3a77a_:

Click to download the PDB-style file with coordinates for d3a77a_.
(The format of our PDB-style files is described here.)

Timeline for d3a77a_: