Lineage for d3a6sa_ (3a6s A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971583Protein Nucleoside triphosphate pyrophosphorylase (MutT) [55813] (3 species)
  7. 2971584Species Escherichia coli K-12 [TaxId:83333] [189082] (3 PDB entries)
  8. 2971585Domain d3a6sa_: 3a6s A: [171835]
    automated match to d1muta_
    complexed with na, tla

Details for d3a6sa_

PDB Entry: 3a6s (more details), 1.8 Å

PDB Description: Crystal structure of the MutT protein
PDB Compounds: (A:) Mutator mutT protein

SCOPe Domain Sequences for d3a6sa_:

Sequence, based on SEQRES records: (download)

>d3a6sa_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli K-12 [TaxId: 83333]}
mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
pviaklkrl

Sequence, based on observed residues (ATOM records): (download)

>d3a6sa_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli K-12 [TaxId: 83333]}
mkklqiavgiirnenneifitrramanklefpggkiemgetpeqavvrelqeevgitpqh
fslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppanepvia
klkrl

SCOPe Domain Coordinates for d3a6sa_:

Click to download the PDB-style file with coordinates for d3a6sa_.
(The format of our PDB-style files is described here.)

Timeline for d3a6sa_: