![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein FMN-binding protein [50477] (1 species) |
![]() | Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (9 PDB entries) |
![]() | Domain d3a6rc_: 3a6r C: [171833] automated match to d1axja_ complexed with cl, fmn; mutant |
PDB Entry: 3a6r (more details), 1.2 Å
SCOPe Domain Sequences for d3a6rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a6rc_ b.45.1.1 (C:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]} mlpgtffevlknqgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq tl
Timeline for d3a6rc_: