SCOPe 2.01: Domain d3a6ob2: 3a6o B:503-585

Lineage for d3a6ob2 (3a6o B:503-585)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)

8. Domain d3a6ob2: 3a6o B:503-585 [171825]
   Other proteins in same PDB: d3a6oa1, d3a6oa3, d3a6ob1, d3a6ob3
   automatically matched to d1bvza2
   complexed with are, ca

Details for d3a6ob2

PDB Entry: 3a6o, 2.8 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex

PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d3a6ob2:

Sequence; same for both SEQRES and ATOM records:

>d3a6ob2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d3a6ob2:

• d3a6ob2 is new in SCOPe 2.01-stable
  
• d3a6ob2 appears in SCOPe 2.02
  
• d3a6ob2 appears in the current release, SCOPe 2.08