![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries) |
![]() | Domain d3a6ob1: 3a6o B:1-120 [171824] Other proteins in same PDB: d3a6oa2, d3a6oa3, d3a6ob2, d3a6ob3 automated match to d1ji2a1 complexed with are, ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3a6o (more details), 2.8 Å
SCOPe Domain Sequences for d3a6ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a6ob1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d3a6ob1: