Lineage for d3a6oa2 (3a6o A:503-585)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2420087Protein Maltogenic amylase [51031] (4 species)
  7. 2420101Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)
  8. 2420108Domain d3a6oa2: 3a6o A:503-585 [171822]
    Other proteins in same PDB: d3a6oa1, d3a6oa3, d3a6ob1, d3a6ob3
    automated match to d1ji2a2
    complexed with are, ca

Details for d3a6oa2

PDB Entry: 3a6o (more details), 2.8 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d3a6oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6oa2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d3a6oa2:

Click to download the PDB-style file with coordinates for d3a6oa2.
(The format of our PDB-style files is described here.)

Timeline for d3a6oa2: