![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Maltogenic amylase [51031] (4 species) |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries) |
![]() | Domain d3a6oa2: 3a6o A:503-585 [171822] Other proteins in same PDB: d3a6oa1, d3a6oa3, d3a6ob1, d3a6ob3 automatically matched to d1bvza2 complexed with are, ca |
PDB Entry: 3a6o (more details), 2.8 Å
SCOPe Domain Sequences for d3a6oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a6oa2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d3a6oa2: