Lineage for d3a6oa1 (3a6o A:1-120)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937592Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 937758Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 937773Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (16 PDB entries)
  8. 937784Domain d3a6oa1: 3a6o A:1-120 [171821]
    Other proteins in same PDB: d3a6oa2, d3a6oa3, d3a6ob2, d3a6ob3
    automatically matched to d1bvza1
    complexed with are, ca

Details for d3a6oa1

PDB Entry: 3a6o (more details), 2.8 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d3a6oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6oa1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOPe Domain Coordinates for d3a6oa1:

Click to download the PDB-style file with coordinates for d3a6oa1.
(The format of our PDB-style files is described here.)

Timeline for d3a6oa1: