SCOP 1.67: Domain d2psr__: 2psr -

Lineage for d2psr__ (2psr -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (16 species)

7. Species Human (Homo sapiens), psoriasin s100a7 [TaxId:9606] [47485] (3 PDB entries)

8. Domain d2psr__: 2psr - [17182]
   complexed with ca, zn

Details for d2psr__

PDB Entry: 2psr, 2.05 Å

PDB Description: human psoriasin (s100a7) ca2+ and zn2+ bound form (crystal form ii)

SCOP Domain Sequences for d2psr__:

Sequence; same for both SEQRES and ATOM records:

>d2psr__ a.39.1.2 (-) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7}
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcs

Timeline for d2psr__:

• d2psr__ first appeared (with stable ids) in SCOP 1.55
  
• d2psr__ appears in SCOP 1.65
  
• d2psr__ appears in SCOP 1.69
  
• d2psr__ appears in the current release, SCOPe 2.08, called d2psra_