Lineage for d2psr__ (2psr -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47532Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 47533Protein Calcyclin (S100) [47479] (9 species)
  7. 47549Species Human (Homo sapiens), psoriasin s100a7 [TaxId:9606] [47485] (3 PDB entries)
  8. 47552Domain d2psr__: 2psr - [17182]

Details for d2psr__

PDB Entry: 2psr (more details), 2.05 Å

PDB Description: human psoriasin (s100a7) ca2+ and zn2+ bound form (crystal form ii)

SCOP Domain Sequences for d2psr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psr__ a.39.1.2 (-) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7}
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcs

SCOP Domain Coordinates for d2psr__:

Click to download the PDB-style file with coordinates for d2psr__.
(The format of our PDB-style files is described here.)

Timeline for d2psr__: