Lineage for d3a6lf_ (3a6l F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885804Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1885805Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 1885806Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 1885807Protein Creatininase [102217] (1 species)
  7. 1885808Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 1885869Domain d3a6lf_: 3a6l F: [171818]
    automated match to d1j2ta_
    complexed with cl, zn; mutant

Details for d3a6lf_

PDB Entry: 3a6l (more details), 2 Å

PDB Description: e122q mutant creatininase, zn-zn type
PDB Compounds: (F:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6lf_ c.125.1.1 (F:) Creatininase {Pseudomonas putida [TaxId: 303]}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyq
nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6lf_:

Click to download the PDB-style file with coordinates for d3a6lf_.
(The format of our PDB-style files is described here.)

Timeline for d3a6lf_: