Lineage for d3a6kf_ (3a6k F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169844Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2169845Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2169846Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 2169847Protein Creatininase [102217] (1 species)
  7. 2169848Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 2169915Domain d3a6kf_: 3a6k F: [171812]
    automated match to d1j2ta_
    complexed with cl, mn, zn; mutant

Details for d3a6kf_

PDB Entry: 3a6k (more details), 2.2 Å

PDB Description: the e122q mutant creatininase, mn-zn type
PDB Compounds: (F:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6kf_ c.125.1.1 (F:) Creatininase {Pseudomonas putida [TaxId: 303]}
svfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerigal
vmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyqn
smfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvfe
tslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelile
vcvqgiadaireefppt

SCOPe Domain Coordinates for d3a6kf_:

Click to download the PDB-style file with coordinates for d3a6kf_.
(The format of our PDB-style files is described here.)

Timeline for d3a6kf_: