Lineage for d1psrb_ (1psr B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.2: S100 proteins [47478] (1 protein) Protein Calcyclin (S100) [47479] (9 species) Species Human (Homo sapiens), psoriasin s100a7 [TaxId:9606] [47485] (3 PDB entries) 
Domain d1psrb_: 1psr B: [17181]
Details for d1psrb_
PDB Entry: 1psr (more details), 1.05 Å
PDB Description: human psoriasin (s100a7)
SCOP Domain Sequences for d1psrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psrb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7}
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq
SCOP Domain Coordinates for d1psrb_:
Click to download the PDB-style file with coordinates for d1psrb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1psrb_:
- d1psrb_ appears in SCOP 1.57
- d1psrb_ appears in the current release, SCOPe 2.08
View in 3D
