Lineage for d3a6gc_ (3a6g C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151348Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2151349Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2151350Family c.125.1.1: Creatininase [102216] (2 protein domains)
  6. 2151351Protein Creatininase [102217] (1 species)
  7. 2151352Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 2151403Domain d3a6gc_: 3a6g C: [171796]
    automated match to d1j2ta_
    complexed with mn, zn; mutant

Details for d3a6gc_

PDB Entry: 3a6g (more details), 2 Å

PDB Description: W154F mutant creatininase
PDB Compounds: (C:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6gc_:

Sequence, based on SEQRES records: (download)

>d3a6gc_ c.125.1.1 (C:) Creatininase {Pseudomonas putida [TaxId: 303]}
svfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerigal
vmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyen
smfivegidlalrelryagiqdfkvvvlsyfdfvkdpaviqqlypegflgwdiehggvfe
tslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelile
vcvqgiadaireefpp

Sequence, based on observed residues (ATOM records): (download)

>d3a6gc_ c.125.1.1 (C:) Creatininase {Pseudomonas putida [TaxId: 303]}
svfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerigal
vmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghyen
smfivegidlalrelryagiqdfkvvvlsyfdfvkdpaviqqlypegfldiehggvfets
lmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelilevc
vqgiadaireefpp

SCOPe Domain Coordinates for d3a6gc_:

Click to download the PDB-style file with coordinates for d3a6gc_.
(The format of our PDB-style files is described here.)

Timeline for d3a6gc_: