SCOP 1.63: Domain d1bt6b_: 1bt6 B:

Lineage for d1bt6b_ (1bt6 B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (9 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (15 species)

7. Species Human (Homo sapiens), P11 s100a10, calpactin [TaxId:9606] [47484] (2 PDB entries)
   ligand of annexin II

8. Domain d1bt6b_: 1bt6 B: [17179]
   complexed with ace

Details for d1bt6b_

PDB Entry: 1bt6, 2.4 Å

PDB Description: p11 (s100a10), ligand of annexin ii in complex with annexin ii n-terminus

SCOP Domain Sequences for d1bt6b_:

Sequence; same for both SEQRES and ATOM records:

>d1bt6b_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin}
psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
crdgkvgfqsffsliagltiacndyfvvhmk

Timeline for d1bt6b_:

• d1bt6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bt6b_ appears in SCOP 1.61
  
• d1bt6b_ appears in SCOP 1.65
  
• d1bt6b_ appears in the current release, SCOPe 2.08