Lineage for d1bt6b_ (1bt6 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.2: S100 proteins [47478] (1 protein) Protein Calcyclin (S100) [47479] (9 species) 
Species Human (Homo sapiens), P11 s100a10, calpactin [TaxId:9606] [47484] (2 PDB entries) 
Domain d1bt6b_: 1bt6 B: [17179]
Details for d1bt6b_
PDB Entry: 1bt6 (more details), 2.4 Å
PDB Description: p11 (s100a10), ligand of annexin ii in complex with annexin ii n-terminus
SCOP Domain Sequences for d1bt6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bt6b_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin}
psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
crdgkvgfqsffsliagltiacndyfvvhmk
SCOP Domain Coordinates for d1bt6b_:
Click to download the PDB-style file with coordinates for d1bt6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bt6b_:
- d1bt6b_ appears in SCOP 1.57
- d1bt6b_ appears in the current release, SCOPe 2.08
View in 3D
