SCOPe 2.01: Domain d3a6fb_: 3a6f B:

Lineage for d3a6fb_ (3a6f B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.125: Creatininase [102214] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.125.1: Creatininase [102215] (1 family)

5. Family c.125.1.1: Creatininase [102216] (1 protein)

6. Protein Creatininase [102217] (1 species)

7. Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)

8. Domain d3a6fb_: 3a6f B: [171789]
   automated match to d1j2ta_
   complexed with cac, mn, zn; mutant

Details for d3a6fb_

PDB Entry: 3a6f, 1.78 Å

PDB Description: w174f mutant creatininase, type ii

PDB Compounds: (B:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6fb_:

Sequence; same for both SEQRES and ATOM records:

>d3a6fb_ c.125.1.1 (B:) Creatininase {Pseudomonas putida [TaxId: 303]}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgfdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

Timeline for d3a6fb_:

• d3a6fb_ is new in SCOPe 2.01-stable
  
• d3a6fb_ appears in SCOPe 2.02
  
• d3a6fb_ appears in the current release, SCOPe 2.08