Lineage for d3a6fa_ (3a6f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922751Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2922752Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2922753Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 2922754Protein Creatininase [102217] (1 species)
  7. 2922755Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 2922780Domain d3a6fa_: 3a6f A: [171788]
    automated match to d1j2ta_
    complexed with cac, mn, zn; mutant

Details for d3a6fa_

PDB Entry: 3a6f (more details), 1.78 Å

PDB Description: w174f mutant creatininase, type ii
PDB Compounds: (A:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6fa_ c.125.1.1 (A:) Creatininase {Pseudomonas putida [TaxId: 303]}
sksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaerig
alvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghy
ensmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgfdiehggv
fetslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgeli
levcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6fa_:

Click to download the PDB-style file with coordinates for d3a6fa_.
(The format of our PDB-style files is described here.)

Timeline for d3a6fa_: