Lineage for d3a6ec_ (3a6e C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885804Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1885805Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 1885806Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 1885807Protein Creatininase [102217] (1 species)
  7. 1885808Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 1885853Domain d3a6ec_: 3a6e C: [171784]
    automated match to d1j2ta_
    complexed with cac, mn, zn; mutant

Details for d3a6ec_

PDB Entry: 3a6e (more details), 2 Å

PDB Description: w174f mutant creatininase, type i
PDB Compounds: (C:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6ec_ c.125.1.1 (C:) Creatininase {Pseudomonas putida [TaxId: 303]}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgfdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6ec_:

Click to download the PDB-style file with coordinates for d3a6ec_.
(The format of our PDB-style files is described here.)

Timeline for d3a6ec_: