SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3a6eb_ (3a6e B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151348Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2151349Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2151350Family c.125.1.1: Creatininase [102216] (2 protein domains)
  6. 2151351Protein Creatininase [102217] (1 species)
  7. 2151352Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 2151396Domain d3a6eb_: 3a6e B: [171783]
    automated match to d1j2ta_
    complexed with cac, mn, zn; mutant

Details for d3a6eb_

PDB Entry: 3a6e (more details), 2 Å

PDB Description: W174F mutant creatininase, type I
PDB Compounds: (B:) creatinine amidohydrolase

SCOPe Domain Sequences for d3a6eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6eb_ c.125.1.1 (B:) Creatininase {Pseudomonas putida [TaxId: 303]}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgfdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOPe Domain Coordinates for d3a6eb_:

Click to download the PDB-style file with coordinates for d3a6eb_.
(The format of our PDB-style files is described here.)

Timeline for d3a6eb_: