Lineage for d3a6bh_ (3a6b H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740618Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)
  8. 2740626Domain d3a6bh_: 3a6b H: [171772]
    Other proteins in same PDB: d3a6bl_, d3a6by_
    automated match to d1c08b_
    mutant

Details for d3a6bh_

PDB Entry: 3a6b (more details), 1.8 Å

PDB Description: Crystal Structure of HyHEL-10 Fv mutant LN32D complexed with hen egg white lysozyme
PDB Compounds: (H:) IG VH, anti-lysozyme

SCOPe Domain Sequences for d3a6bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a6bh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d3a6bh_:

Click to download the PDB-style file with coordinates for d3a6bh_.
(The format of our PDB-style files is described here.)

Timeline for d3a6bh_: