Lineage for d1a4pb_ (1a4p B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47532Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 47533Protein Calcyclin (S100) [47479] (9 species)
  7. 47544Species Human (Homo sapiens), P11 s100a10, calpactin [TaxId:9606] [47484] (2 PDB entries)
  8. 47546Domain d1a4pb_: 1a4p B: [17177]

Details for d1a4pb_

PDB Entry: 1a4p (more details), 2.25 Å

PDB Description: p11 (s100a10), ligand of annexin ii

SCOP Domain Sequences for d1a4pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4pb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin}
psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
crdgkvgfqsffsliagltiacndyfvvhmk

SCOP Domain Coordinates for d1a4pb_:

Click to download the PDB-style file with coordinates for d1a4pb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a4pa_