Lineage for d1a4pa_ (1a4p A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.2: S100 proteins [47478] (1 protein) Protein Calcyclin (S100) [47479] (11 species) 
Species Human (Homo sapiens), P11 s100a10, calpactin [TaxId:9606] [47484] (2 PDB entries) 
Domain d1a4pa_: 1a4p A: [17176]
Details for d1a4pa_
PDB Entry: 1a4p (more details), 2.25 Å
PDB Description: p11 (s100a10), ligand of annexin ii
SCOP Domain Sequences for d1a4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin}
psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
crdgkvgfqsffsliagltiacndyfvvhmkq
SCOP Domain Coordinates for d1a4pa_:
Click to download the PDB-style file with coordinates for d1a4pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a4pa_:
- d1a4pa_ first appeared (with stable ids) in SCOP 1.55
- d1a4pa_ appears in SCOP 1.57
- d1a4pa_ appears in SCOP 1.61
- d1a4pa_ appears in the current release, SCOPe 2.08
View in 3D
