Lineage for d3a5ms_ (3a5m S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969675Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2969714Domain d3a5ms_: 3a5m S: [171755]
    Other proteins in same PDB: d3a5mc1, d3a5mc2
    automated match to d1c0fs_
    complexed with atp, ca, mg

Details for d3a5ms_

PDB Entry: 3a5m (more details), 2.4 Å

PDB Description: Crystal Structure of a Dictyostelium P109I Mg2+-Actin in Complex with Human Gelsolin Segment 1
PDB Compounds: (S:) gelsolin

SCOPe Domain Sequences for d3a5ms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5ms_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

SCOPe Domain Coordinates for d3a5ms_:

Click to download the PDB-style file with coordinates for d3a5ms_.
(The format of our PDB-style files is described here.)

Timeline for d3a5ms_: