SCOPe 2.05: Domain d3a5fb_: 3a5f B:

Lineage for d3a5fb_ (3a5f B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (12 species)

7. Species Clostridium botulinum [TaxId:441770] [189380] (1 PDB entry)

8. Domain d3a5fb_: 3a5f B: [171752]
   automated match to d1o5ka_
   complexed with gol

Details for d3a5fb_

PDB Entry: 3a5f, 1.19 Å

PDB Description: High-resolution structure of DHDPS from Clostridium botulinum in complex with pyruvate

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3a5fb_:

Sequence; same for both SEQRES and ATOM records:

>d3a5fb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Clostridium botulinum [TaxId: 441770]}
sifkgsgvaiitpftntgvdfdklseliewhiksktdaiivcgttgeattmteterketi
kfvidkvnkripviagtgsnntaasiamskwaesigvdgllvitpyynkttqkglvkhfk
avsdavstpiiiynvpgrtglnitpgtlkelcedknivavxeasgnisqiaqikalcgdk
ldiysgnddqiipilalggigvisvlanvipedvhnmcelylngkvnealkiqldslalt
nalfietnpipvktamnlmnmkvgdlrlplcemnennleilkkelkaynlm

Timeline for d3a5fb_:

• d3a5fb_ first appeared in SCOPe 2.01
  
• d3a5fb_ appears in SCOPe 2.04
  
• d3a5fb_ appears in SCOPe 2.06
  
• d3a5fb_ appears in the current release, SCOPe 2.08