SCOPe 2.02: Domain d1uwob_: 1uwo B:

Lineage for d1uwob_ (1uwo B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (6 PDB entries)

8. Domain d1uwob_: 1uwo B: [17175]

Details for d1uwob_

PDB Entry: 1uwo

PDB Description: calcium form of human s100b, nmr, 20 structures

PDB Compounds: (B:) s100b

SCOPe Domain Sequences for d1uwob_:

Sequence; same for both SEQRES and ATOM records:

>d1uwob_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

Timeline for d1uwob_:

• d1uwob_ first appeared (with stable ids) in SCOP 1.55
  
• d1uwob_ appears in SCOPe 2.01
  
• d1uwob_ appears in SCOPe 2.03
  
• d1uwob_ appears in the current release, SCOPe 2.08