Lineage for d1uwob_ (1uwo B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97368Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 97369Protein Calcyclin (S100) [47479] (11 species)
  7. 97400Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (1 PDB entry)
  8. 97402Domain d1uwob_: 1uwo B: [17175]

Details for d1uwob_

PDB Entry: 1uwo (more details)

PDB Description: calcium form of human s100b, nmr, 20 structures

SCOP Domain Sequences for d1uwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwob_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100b}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

SCOP Domain Coordinates for d1uwob_:

Click to download the PDB-style file with coordinates for d1uwob_.
(The format of our PDB-style files is described here.)

Timeline for d1uwob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uwoa_