Lineage for d3a58f_ (3a58 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2867988Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)
  8. 2867991Domain d3a58f_: 3a58 F: [171749]
    automated match to d1ow3b_
    complexed with gnp, mg, po4

Details for d3a58f_

PDB Entry: 3a58 (more details), 2.6 Å

PDB Description: crystal structure of sec3p - rho1p complex from saccharomyces cerevisiae
PDB Compounds: (F:) GTP-binding protein RHO1

SCOPe Domain Sequences for d3a58f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a58f_ c.37.1.8 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nsirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvelalwdta
gqedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilvgckvdl
rndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaatraslmg
k

SCOPe Domain Coordinates for d3a58f_:

Click to download the PDB-style file with coordinates for d3a58f_.
(The format of our PDB-style files is described here.)

Timeline for d3a58f_: